PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.C00878.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MYB
Protein Properties Length: 959aa    MW: 105914 Da    PI: 5.2062
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.C00878.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.81.2e-184894148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+e d++l +av+ + g++Wk+Ia+ ++ gRt+ qc +rwqk+l
   Pahal.C00878.1 48 KGNWTAEQDDILRKAVETYKGKNWKKIAESFP-GRTDVQCLHRWQKVL 94
                     79******************************.************986 PP

2Myb_DNA-binding61.22.2e-19100146148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W++eEde++++ v++lG++ W+tIa+ ++ gR +kqc++rw+++l
   Pahal.C00878.1 100 KGPWSKEEDEIIIEMVNKLGPKKWSTIAQALP-GRIGKQCRERWHNHL 146
                      79******************************.*************97 PP

3Myb_DNA-binding48.22.6e-15152194145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +++WT+eE+ +l++a++ +G++ W+   + ++ gRt++ +k++w+
   Pahal.C00878.1 152 KDAWTQEEEIKLIHAHQTYGNK-WAELTKFLP-GRTDNAIKNHWH 194
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.6724394IPR017930Myb domain
SuperFamilySSF466892.15E-1546101IPR009057Homeodomain-like
SMARTSM007177.7E-174796IPR001005SANT/Myb domain
PfamPF002493.7E-164894IPR001005SANT/Myb domain
CDDcd001672.67E-145094No hitNo description
Gene3DG3DSA:1.10.10.601.8E-2450110IPR009057Homeodomain-like
PROSITE profilePS5129432.06695150IPR017930Myb domain
SuperFamilySSF466894.31E-3197193IPR009057Homeodomain-like
SMARTSM007175.1E-1899148IPR001005SANT/Myb domain
PfamPF002491.3E-17100146IPR001005SANT/Myb domain
CDDcd001671.18E-15102146No hitNo description
Gene3DG3DSA:1.10.10.607.9E-26111152IPR009057Homeodomain-like
SMARTSM007172.8E-14151199IPR001005SANT/Myb domain
PROSITE profilePS5129419.607151201IPR017930Myb domain
PfamPF002491.9E-13152194IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-21153201IPR009057Homeodomain-like
CDDcd001674.35E-11154194No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0032875Biological Processregulation of DNA endoreduplication
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 959 aa     Download sequence    Send to blast
MTSEGQMTSK GTEASAPAVP PDEGVRREPQ KGRLPNGRTT GPARRSSKGN WTAEQDDILR  60
KAVETYKGKN WKKIAESFPG RTDVQCLHRW QKVLNPELVK GPWSKEEDEI IIEMVNKLGP  120
KKWSTIAQAL PGRIGKQCRE RWHNHLNPGI NKDAWTQEEE IKLIHAHQTY GNKWAELTKF  180
LPGRTDNAIK NHWHSSVKKK IDSYRASGLL AQFQGLAPVE YTTGGLSVDS SSAMANQISE  240
DSCLNVFREV EDSTEFSQSS FAKGSCSQEE QTDVALGSHL NVHESLCQDG FTNADNAASA  300
LPEMHHQLST SDMDQDKHFQ DELSQGMDLD KHLQLQQEFS QGMDLHLDID EVPNNFVITD  360
SQASNELTGQ FQDTQIMHSS ENDGVSLIPY AVTPCVSILP SVPGCENNIN MMCEVGIKNE  420
DHFQSEQWQN ISIQPGSYSS EAASNFSVPL YPLQTSEPAT MMGDPLYYQS SVTSLPPSFI  480
SSDGASNASD VKFEMSRFPV SHQDLEIKTC HNSSGDPDQS SYINSEGDRN RTSEPMDSIP  540
DSEKKQLVDL EQSCLEPTAY IGKEALSSHG DSVLSKKEDA GALCYEPPCF ASFEVPFVSC  600
ELVTSSDLPE YSPLGIRELM RSSLNFPTPV RLWGSPTRDG SPDAVLKNAA KSFVCTPSIM  660
KKRPRDLSSP SPDVRNEKKL NTEKDCGRSG MYSTRIGKSC MDTPDDFVDL VSPTRKTAFQ  720
KKLKLSQENK ENVNQNTDQG ENEGNAKHSA GILTDSSVDN LNTPKHGPNY ESQRLNTSAK  780
AWSNSKDIIF SRSKPSELLV EKSIPCIDAD HEYVNILADT PGIKRGLESP SAWKSPLFTP  840
FQDAYFMSPA SRAFDALGLV KQINEQSAAA LEEAHEVLAS GSPWKRHCKE NSDKENTAWK  900
NEVGTSKPPS KLMAEGRVLD FNECSTPVRK KEDKKMDLAL GGSASSPVAS SYLRMNVR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-65482016159MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-65482016159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00505DAPTransfer from AT5G11510Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004960645.10.0PREDICTED: myb-related protein 3R-1
RefseqXP_004960646.10.0PREDICTED: myb-related protein 3R-1
RefseqXP_004960647.10.0PREDICTED: myb-related protein 3R-1
TrEMBLK3Z3V00.0K3Z3V0_SETIT; Uncharacterized protein
STRINGSi021218m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.21e-104myb domain protein 3r-4